DPCstruct | MC27082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 422 ± 34 aa |
| Standard deviation of domain lengths | 33.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0159- CL0202- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090RXE2 | 2-400 | KLHGNWDLSALGEHLAIAVDVTNLTNTGLFLYSRVEDNSGNDASGIARGKYIPANSTQTVYVSVKDTPAISDIVNTLGMRELPAKAL… |
| M5TDS3 | 7-359 | LRNASIRLTSPGWDLSKYLGVAIDITNRGESDIAVLGTVSVRNDKTSLDSVVSLKPGQTDTMFIVFCRAKAPDYMAEYLTGMRAFPG… |
| R6X2K2 | 62-504 | None |
| A0A7V3T4B3 | 9-379 | None |
| A0A1S9CBT8 | 20-466 | None |
| F0YZW4 | 25-473 | None |
| A0A2E6TMH3 | 538-935 | None |
| A0A3D1UE40 | 361-817 | None |
| A0A7Y8I447 | 1-433 | None |
| A0A1I3HS60 | 218-666 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.