DPCstruct | MC27080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 59.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090RQK0 | 1-98 | MLWPIKQKYGNGISWADLMILAGNVAYESMGFKTFGFAAGREDIWHPEKDIYWGSEKEWLAPSGGEGTRYSGERDLENPLAAVMMGL… |
| M4RV56 | 144-237 | LQPIKLKYGENISWADLIMLTGNLALEQMGFKTYGFGAGRIDYWEADDASYWGPETVMATQDKRWVGEPGSDDYDLENPLAASRQSL… |
| A0A7K1AMW2 | 1-78 | None |
| A0A379UZ97 | 63-148 | None |
| A0A212DUC2 | 77-165 | None |
| A0A455U2H0 | 32-126 | None |
| A0A8B4PT93 | 20-89 | None |
| A0A432VFP9 | 528-620 | None |
| A0A2X1MTB3 | 4-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.