DPCstruct | MC2708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7R5X4 | 71-188 | AIINFGKWDNKSLNDFIENSKKDKNNGDRIKYITQGFIGVPCQGNTLVGAKNIPEKFIINLGGVDCSTLSDYVLALVFANDIKDFSE… |
| A0A2N8N8Q8 | 26-134 | NLTFSAEDVAAFEGCMQSVRSAAPQTVGDATLAAARHFVGRPYVAATLEKDPERLVVNLREWDCTTLVESAVALARTARSDAPSFAT… |
| A0A7C2Y1W7 | 33-158 | None |
| A0A2N4S8V6 | 22-137 | None |
| A0A378KL76 | 2-115 | None |
| A0A3A0D364 | 69-191 | None |
| A0A2U2B5D2 | 23-150 | None |
| A0A7V5SAY2 | 17-162 | None |
| A0A7C7VD43 | 96-220 | None |
| A0A1H8EVM3 | 170-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.