DPCstruct | MC27078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 169 ± 29 aa |
| Standard deviation of domain lengths | 28.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.60 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF02322- PF01654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090RJT4 | 2-194 | TDKQIYKDMTKFWGKLFAINFALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEALVAFFLESTFVGLFFFGWDRLSKRQHLAV… |
| A0A2U9PXA6 | 58-237 | DDSVALGLAQRWAKVSAVLFAIGAVSGTVLSFEMGLLWPGLMGRFGDVLGLPFAFEGLSFFVEAIFLGIYLYGWGRMPPRRHLLTLI… |
| A0A380P7V7 | 1-150 | None |
| A0A0B0I8K2 | 10-188 | None |
| A0A378LQ48 | 7-217 | None |
| A0A2N8J5Z5 | 3-139 | None |
| A0A4Y8LZ29 | 17-221 | None |
| X8FDV4 | 2-133 | None |
| A0A0K0GJN5 | 26-215 | None |
| A0A537YA48 | 46-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.