DPCstruct | MC27077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A774NA18 | 340-418 | TRLAADAVGATKMDRPEWIAVDPYHAGSVYCTLTNNSDRGKEGKAPVDAANPRAKNVYGHIIHWLEHNGDPTALQFAWD |
| A0A6J6KVU6 | 42-123 | VHTRLAADVVGATKMDRPEWIAGAPTGEMYVTLTNNTQRGTTGKAGVDKANPTAVNTYGHIVRFKDANDHLGGTFNWEVFAL |
| A0A1G7Q8N1 | 6-99 | None |
| A0A2D6N537 | 94-188 | None |
| A0A2E3NK80 | 544-625 | None |
| A0A377HIW3 | 48-126 | None |
| A0A6G3VE26 | 1-77 | None |
| A0A522DD55 | 395-483 | None |
| A0A090TD37 | 1-78 | None |
| A0A7C1P0C7 | 96-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.