DPCstruct | MC27076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 204 ± 35 aa |
| Standard deviation of domain lengths | 34.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090RIF4 | 2-214 | FLFAFSIVLTAMIGGLQFEALGADGGMVQYSIKSMADTESVRWLFDNAILANWLGFGGGVLGVILIVMLGVGVAENSGMLAAVIKKV… |
| A0A4U9HY11 | 10-203 | YLIVILAAATAILSAFNVSARNPADGSMVVVKNLLSIEGLHWFLPNVIKNFSGFAPLGAILALVLGAGLAERSGLLPALMVKMASHV… |
| A0A812IR89 | 316-537 | None |
| W4PB99 | 2-216 | None |
| T0CWU4 | 5-161 | None |
| A0A543KLJ7 | 2-186 | None |
| A0A1C5SPC8 | 17-273 | None |
| A0A8B4PEJ5 | 2-170 | None |
| A0A0G3HBD9 | 301-531 | None |
| A0A1V1V6Z2 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.