DPCstruct | MC27075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.19 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090RH03 | 5-71 | EPIYLPADERVDYHRIIFARGYYASALHEIAHWCVAGPKRRLLEDFGYWYEPDGRSAQVQAEFEKSR |
| A0A353EHZ7 | 42-107 | EPLYVPASETEPAKIIFAHGFVTSACHEIAHWCYAGKERRQLVDYGYWYAGDDRNQEQQDTFEKVE |
| L2FAU5 | 94-162 | None |
| A0A2A5ASW9 | 26-95 | None |
| A0A5N8TEI8 | 27-96 | None |
| A0A1T0CB60 | 50-118 | None |
| A0A378PMS8 | 98-166 | None |
| A0A420EIH4 | 17-86 | None |
| A0A3C0T9J1 | 27-93 | None |
| A0A2X1QGE4 | 29-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.