DPCstruct | MC27074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 10.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349YGJ9 | 159-228 | MDADSIRKKQLEIVSYVVDVCKRHNLNIYMGGGTLLGAVRHSGYIPWDDDVDLILPMNDYKMLTKIILEE |
| A0A090RGW5 | 5-73 | VKVVQSHLLKMMNTLSEFFDKENIQYVAVGGTVLGAYRHSGFIPWDDDIDLAVPYDDFNRLIAMADSLP |
| C4K324 | 8-62 | None |
| A0A6P8HJ75 | 293-388 | None |
| A0A819SXH5 | 56-133 | None |
| A0A2B4RYY7 | 886-984 | None |
| C2KU37 | 1-99 | None |
| A0A413K960 | 201-283 | None |
| A0A4N9N4D1 | 22-97 | None |
| A0A6I1ELC0 | 11-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.