DPCstruct | MC2707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328ARJ5 | 16-147 | MCCTTLQIRELDKLPWGRCTHQRADQPGCAIWGEHPPSCKRYHCFWRRSEDLLPPELFPPDCGFLVTMDNVEIWPGVVNVCPDPRRP… |
| A0A522CN69 | 8-131 | CGPCGMCCKVLAVDDLAKPAGTMCGHFRGGCTIYADRPHACRTFECVWLMDPEMPHRFRPDQTKVMLDQDPAGARLIARCDPANPQA… |
| A0A502FYU5 | 19-156 | None |
| A0A2A4VZK0 | 6-125 | None |
| A0A0Q7VYC1 | 2-122 | None |
| A0A3S0BE84 | 61-184 | None |
| A0A7V9A8Q6 | 19-142 | None |
| T0I075 | 5-117 | None |
| A0A3A6NVU3 | 19-165 | None |
| A0A2D8FUJ7 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.