DPCstruct | MC27066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 130 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8X837 | 2-116 | QIVPRVERDERFNAGVIMFCRSRRFLDAQVALHVDKLRALDPRADEELIAAHLNTLARIAAGDLTAGPIAALEQAERFHWLASPSST… |
| A0A090R0U9 | 1-141 | MKKLVRFSVVRFMPFTETQEFANVGIVLHVPKDGTVLYKLAGKRFGRVSQFFDDLDGCLYSNAIQMFEAELDRIKEFTHDISGKALV… |
| A0A6P0V8B4 | 2-136 | None |
| A0A2E8JQE0 | 10-127 | None |
| A0A7Y8TGB4 | 22-152 | None |
| A0A6M4GYX0 | 2-143 | None |
| A0A800J7Y5 | 30-160 | None |
| A0A317N2E7 | 280-409 | None |
| A0A538PWA9 | 323-477 | None |
| A0A6M5ZAM2 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.