DPCstruct | MC27065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 154 ± 21 aa |
| Standard deviation of domain lengths | 21.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H880 | 1-130 | MEKKIQEERKPEERLKKKKRQLGIDGPIHITVKETKSLKMYGKLNASVFTACKEHMRPAKKHLKALNTNRKKIIRKQIIPLGNHIYR… |
| A0A2Y9FJB0 | 15-144 | LEKGTDAPCLEGSSSTIPARDSLVCQAKGLGQDTFKICKEYLRPLKKFLRKLHLPRDLPQKKKLKYMKQSLVVLGDHINTFLQHHCQ… |
| A0A0P0XA01 | 238-377 | None |
| A0A2I0TQA4 | 20-161 | None |
| A0A164MZU9 | 197-386 | None |
| A0A835RGU4 | 376-527 | None |
| A0A7M4EXF8 | 2-177 | None |
| H3BD82 | 845-999 | None |
| F6S9I3 | 103-258 | None |
| A0A2D4HBX5 | 446-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.