DPCstruct | MC27061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.48 |
| Pfam Score | 96.55 |
| Assigned Pfam label(s) | CL0023- CL0220- CL0329- CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9JED1 | 2-94 | SSTEAEKMLLGLLNLYHKYTQDSDAMNKPALLKMMTENFPTFLMACERKSPNFFEKFFKKKDANHDEKINFSEFLSSVAAIATDLHN… |
| A0A671W834 | 54-163 | TTKPQLLPLYVLHLLSAAMSELEVCMEKLILLFHKYADEDGDKKHLSKKEFKKLVETELPTFLKTQKNPKAVECIMKDLDTNKDDKL… |
| A0A3B4A3I8 | 3-105 | None |
| A0A7N4NMZ8 | 1-98 | None |
| A0A4W6FTC2 | 1-82 | None |
| A0A2I4D6E9 | 1-106 | None |
| A0A672UY37 | 109-213 | None |
| A0A484GJ87 | 45-138 | None |
| A0A834B9Q6 | 1-97 | None |
| A0A498LYP1 | 552-645 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.