DPCstruct | MC27058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3QB40 | 137-207 | VEKEKPNFEPSGKLAEDTNTYRGVLIKYNEPSDAHIPKLRWRLYPFKGDEALPVLYIHRQSAYLIGRDRKI |
| Q9ZQ27 | 1-78 | MIEKHGVRCFELSRKLAEETNIYKGITLLFNNPVDNRKPKERWRLYHFKDGEPLKETLCIHYQICYLFGRERKIRHSY |
| D5AA17 | 285-352 | None |
| A0A0R3TJ10 | 121-188 | None |
| G5B4G2 | 188-246 | None |
| A0A2P6S2G6 | 9-80 | None |
| A9RPJ2 | 1-65 | None |
| K7MR27 | 211-282 | None |
| A0A1X7VK70 | 40-103 | None |
| A0A6P7GCQ4 | 34-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.