DPCstruct | MC27057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3KIM5 | 43-129 | GQITNLSRAKNLARQAAEEANGGIGVYRAEASMHGSIGQTPCTPNENGTWTFTFTGGAPGEAPTVESAVTVNPSNWEISVDYNGPIR |
| A0A3R7PBV2 | 12-101 | AQTKAANQARMRAERLNGGLSRYRADRCMYTLRGEGCLVSNTESGFVFRFQGGAPGWQQQIPPEPTVLTEIRVSADGDRILDVPYNG… |
| A0A1B1TV18 | 156-237 | None |
| A0A0D6APW0 | 6-88 | None |
| K9Q4T3 | 167-246 | None |
| A0A7Y3TRD2 | 90-171 | None |
| B8HU10 | 175-260 | None |
| A0A0H4BGI2 | 11-107 | None |
| A0A5J6Q728 | 90-177 | None |
| A0A7G8F8F3 | 96-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.