DPCstruct | MC27055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 194 ± 21 aa |
| Standard deviation of domain lengths | 21.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0XYF1 | 8-170 | NSYYQQNQKTNLVSIQYKNFNMGAMQGSADWAAQLSFDPCKPKDVLMLTGTDEIKRSWNGYHIESKINLQQGNEVFQKILKQPLTAQ… |
| A0A2X1MF26 | 2-166 | SYQNYHRGVFSSQLQLLVKPIAGKENPWIKSGQSVIFNESVDHGPFPLAQLKKLNLIPSMASIQTTLVNNEVSKPLFDMAKGETPFE… |
| A0A291IJV9 | 8-197 | None |
| A0A824DUJ3 | 1-187 | None |
| A0A0A2WJ87 | 405-621 | None |
| A0A6N4YZT0 | 1-187 | None |
| A0A824WR97 | 1-187 | None |
| A0A4Y4D1Y3 | 29-202 | None |
| A0A824I9U6 | 1-183 | None |
| A0A826FWT3 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.