DPCstruct | MC27051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 46.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3BGG0 | 48-172 | CFMDNENLKNLKKLLSQDQINLSNAIITAINQVENDLCVINPTSAIIDKIEYHFRDNTFHFIFNVSDSYSFVLSEKSRLIIEVPRVA… |
| A0A1Q9G0W2 | 24-119 | SDLAAQLDNISPRVSKSIITAIERAEGVRLTHALIDKISYNSLHSSLSFVFDIDNPLSDQKFEELVIEVPKEALKNVKLPQIKNALT… |
| A0A2T6SPC6 | 121-226 | None |
| M3RUG7 | 7-117 | None |
| A0A496IYZ8 | 435-543 | None |
| A0A1Y3E283 | 11-105 | None |
| A0A2A6XT68 | 104-207 | None |
| A0A514UQC3 | 520-628 | None |
| A0A2A6S4N7 | 327-437 | None |
| J0JYH6 | 204-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.