DPCstruct | MC2705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 30.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06289 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3J410 | 1-61 | MIPLTKLDGQVLWVNPHQIETLEERPGTTALHFLSGKLVVVQEPALVVHQKIVAYRRALGI |
| A0A2N1UVP7 | 1-62 | MIKLTRLDGREFIVNADLIEMFEATPETVVTLTIDKKRMVVRESVDEVWQKVIEYKRLVFSD |
| A0A367AC79 | 110-176 | None |
| A0A1M3NG06 | 15-91 | None |
| A0A4Y9LF76 | 1-58 | None |
| R0BLW2 | 1-65 | None |
| A0A1V5IAL7 | 1-67 | None |
| A0A7W8E3D6 | 15-81 | None |
| A0A7G8BPI6 | 1-67 | None |
| A0A518IU09 | 29-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.