DPCstruct | MC27047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7NFC5 | 12-118 | AGRLLFLGIGLLLALSGCEITTGAAVYGLVEGSSLNQTGKTASDHLASLVTGQDCNILRYQQTGKYCLSSAELAQMEAAEKRDNAGY… |
| A0A2E5LMG3 | 5-98 | LLAVACGTETSVYLLGAGMANFIQSDRLPQDYLAELVTGKECSTLKAMRDKGPLCRESFNPQIYEKPIYCYRTLGKVACYAQPDPYG… |
| A0A1G7XWE7 | 21-112 | None |
| A0A848EAB7 | 7-106 | None |
| A0A2E6VY49 | 9-102 | None |
| A0A2D8QL82 | 3-91 | None |
| A0A2D6T8P9 | 1-100 | None |
| A0A2G1Z5Q5 | 2-96 | None |
| A0A2E3S2N2 | 1-76 | None |
| A0A160JIX5 | 14-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.