DPCstruct | MC27042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 112 ± 20 aa |
| Standard deviation of domain lengths | 19.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 62.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061AWI3 | 69-173 | EDDCATIGCHASCGMLIIYGSACSENKENQYAGPYNTTCLCADDSKFVKQYPSCMNCGWTLWKYYGGYVSSALAACGTLSTEPTGTL… |
| A0A061AVC2 | 1-105 | MYCGLMISADSECSQNTTDNYSGPYEAGCLCGSDDTTFLSYYDSCMSCGWTLWKYYSGYLENALVERASENTVYTATEPTGTSRCST… |
| A0A1E4RYF8 | 83-183 | None |
| A0A0H5CE99 | 84-179 | None |
| A0A0H5C3H2 | 78-193 | None |
| A0A1V2L5Y5 | 69-185 | None |
| A0A0H5C587 | 17-118 | None |
| A0A061AIL7 | 3-166 | None |
| A0A1V2L2B0 | 115-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.