DPCstruct | MC2704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 124 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354K7Y8 | 223-351 | SALTDAQKAELEALEEKETAASARIPRKKAVLKGFLDADTPRITLDEVNQIIEESYSFEEIFRKLTDTHPYPDYWGGSGVTSVYYFL… |
| A0A7K3Z5P1 | 76-192 | ARASSEQKVELDKIVADNSIGLVGEWRRPVLIAIGDLPKDQPRLTAKQAGEIYDRIGRDERALEKEFNKIAGAPDFVGGSGIGRSIY… |
| A0A401I0U7 | 32-145 | None |
| A0A4U7J6Z6 | 82-207 | None |
| A0A329LAW4 | 211-328 | None |
| A0A3A1UP72 | 54-173 | None |
| R6AVX3 | 101-227 | None |
| A0A3A6PAD8 | 53-173 | None |
| A0A358PG04 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.