DPCstruct | MC27038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 165 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z4WB90 | 12-161 | EYEKKIISEGDNFPRVNINKYNLKEVCVLLHNDIFIEEIKNYFRWSDKDINMRLSLLLQEELIKKEKNKFIPNCMIISIEESKKLIE… |
| R6SK23 | 3-181 | ETALRPICMSIGIYGSGDYDGKRIPFPDVYIKDALSQNILYYSYEKPCTIEELAKLCGVPAYYVEDSLRNLLKREAIIEPAKGKYQT… |
| A0A0G8F5U8 | 1-121 | None |
| A0A1E1VHQ0 | 2-148 | None |
| A0A3A4PL88 | 225-403 | None |
| A0A164KPG1 | 4-157 | None |
| A0A0Q0XGK9 | 47-193 | None |
| K5AAQ1 | 1-139 | None |
| I6Z4S5 | 29-210 | None |
| A0A7W0IXE0 | 4-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.