DPCstruct | MC27037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 564 ± 93 aa |
| Standard deviation of domain lengths | 93.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W1L0J4 | 109-733 | LITFYKVAFFNVLKHPITLIILLAWPAMVFNNVASSAAYAEPLSVINVTSIDAIRHYAFDMQILFGCLLMVLWSWQISCYAKRFNMA… |
| A0A2Z4W8E0 | 7-583 | IFNCIKIEFKNIFRIKAIKFIIPIICIYCCYTYVMSIFFEYGVWDVLRASSFVPMILMLLFMVLGFYLAKEEKRYNLDEVFFSIYRG… |
| A0A4Q6GXZ3 | 312-828 | None |
| A0A6N8V7Y7 | 327-1088 | None |
| A0A7V6HAW0 | 2-487 | None |
| A0A252F2Y5 | 3-460 | None |
| A0A256WA55 | 7-538 | None |
| A0A7J9TLK4 | 9-378 | None |
| A0A838QL75 | 25-650 | None |
| A0A354GEE5 | 82-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.