DPCstruct | MC27033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 143 ± 21 aa |
| Standard deviation of domain lengths | 21.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.79 |
| Pfam Score | 84.06 |
| Assigned Pfam label(s) | PF19829- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T0M564 | 15-133 | YEDDIQDLYGGAANFNSRQYSAVVDGQLVNGVADNVVNINGKTVAIEAKFVEDWNKSLRNPLDTKPWAITEQNKMLSQAKKYSNAFD… |
| A0A848M0V4 | 11-149 | GGGSAKPPTAQGPGKWVSKKPAGSAESQRYQQQVTGRPASEVYMVNDVEYDGFSPHQVLLEAKGEQYQQFFDADGIPLPWFARGEGF… |
| A0A3S4VK50 | 195-337 | None |
| A0A7T5K6M0 | 59-228 | None |
| A0A1S2NVQ8 | 625-765 | None |
| A0A2G0Y6C2 | 301-452 | None |
| A0A357NJ84 | 48-254 | None |
| A0A542EJ96 | 4-124 | None |
| V9Y1Z9 | 1-103 | None |
| A0A6N7S2K3 | 413-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.