DPCstruct | MC27031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 198 ± 34 aa |
| Standard deviation of domain lengths | 33.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5TNI0 | 33-252 | CTPLGNKLKAYMSRHEGYRLPPDVYQNCTILCGSITKCYNELKCNNAQELKEDFEIRCSKLEYLTASIHHCMNRFSNAVYQRTYECS… |
| E3LIB6 | 28-213 | QNNEQLCEEAASCLAPYECEQATQYRNTITKFCDFNIDYFPDVRQCLVEFLKDLYLSKSSTEESCLRDFRFLQKNAEEKRAGYDARK… |
| G0M9Y1 | 3-168 | None |
| G0M9X8 | 310-544 | None |
| A0A2P4UYZ8 | 592-812 | None |
| G0MT64 | 1-158 | None |
| G0NF11 | 3-163 | None |
| A0A2G5T8D5 | 25-164 | None |
| G0NL87 | 42-251 | None |
| G0PGW4 | 20-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.