DPCstruct | MC27030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3LFU5 | 4-116 | LPFNDARTEIIRRRKMRQPVLETFTMALWQALRTLRNYHYDLSSRQLLNCTSRGDCTSHLKWEHLKNFREKCRNEGVDQDDYTEQQL… |
| A0A6A5GY85 | 293-393 | SFMEKLPLIAPEQEVLRRRSIRQTVLKMTNNSIWQAMRTIRNYHFNKVTETLVSCSVRSDCATHLRWEHLKAFREKSRSQDMPVDSY… |
| K7GXQ9 | 1013-1105 | None |
| O17878 | 419-551 | None |
| A0A2H2JID2 | 2-89 | None |
| A0A2H2IU59 | 21-108 | None |
| A0A2G5UCH9 | 366-486 | None |
| A0A2G5UA93 | 518-639 | None |
| Q22399 | 97-210 | None |
| A0A1I7UK62 | 143-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.