DPCstruct | MC2703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 47.08 |
| Assigned Pfam label(s) | PF11213- PF07960- PF16892 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847Z368 | 2-55 | EIKKAVIDRIEGSMAVCELEDKSFININIKMFDYKAKEGDHILIYPDKVKKDLN |
| A0A352DPG1 | 1-69 | MTVRAVIDRFEGEYAVLETEGGMTEIHRAHLPGAAREGDIVYYSCGGWSVDREETEKLRRKNSERLNRL |
| A0A1E3NTD0 | 2-70 | None |
| A0A1N6S4Z3 | 68-150 | None |
| A0A511W8D9 | 1-89 | None |
| W7BKL5 | 1-72 | None |
| M8CRR3 | 28-98 | None |
| A0A2V7KFJ1 | 24-119 | None |
| A0A8B5XI96 | 4-92 | None |
| A0A3N4IC75 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.