DPCstruct | MC27028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 401 ± 78 aa |
| Standard deviation of domain lengths | 78.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7Z1F1 | 44-404 | ILLPLSLVLALALVSQGSVQTFAASRPVALLDPAVDSQGNGIDQQILALGPAASQIAIKQLGTNGGGFFNVNSAHPFENPTPLAGFL… |
| A0A199UXY2 | 106-539 | MLLGGEVFVSMLGLHFMKIKLPKKETSHNSATMELTSNDQVELESIKPTVTTPSITSDHLRYNSIRYLGFIVLGYLMLVHFTGYILI… |
| A0A317T4K8 | 35-398 | None |
| A0A819L924 | 4-442 | None |
| A0A1E1VVB2 | 3-296 | None |
| A0A7J7IHL1 | 21-421 | None |
| R1GLK6 | 544-1035 | None |
| A0A3D8T2P8 | 220-711 | None |
| A0A080WIJ9 | 1-301 | None |
| A0A7I4BUL1 | 72-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.