DPCstruct | MC27023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 191 ± 34 aa |
| Standard deviation of domain lengths | 34.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4RPA3 | 9-172 | YEKYLKEYDNTSGLYPGALAELGEKYHQKSYLSREELYELAHLNSTRSSYHVKKNPEDRVEKLTGIAYQIDDTFARLALYSSLMGIG… |
| A0A199UGG0 | 16-215 | GAYAARVETLAGAAASKRELLPLDSFYRGDLPLLLRRRGPKPFLSKSELLRVVQWKLSRGQWRPRLMGYAEALGEAEVEAASRAALA… |
| A0A7R9PNJ1 | 65-236 | None |
| R1EA12 | 12-150 | None |
| A0A1J5A9H9 | 8-185 | None |
| Q2HDK7 | 18-225 | None |
| A0A830CEY0 | 1-170 | None |
| A0A4S0N9S7 | 75-315 | None |
| K1Q8C3 | 2-156 | None |
| A0A1Q5AQF2 | 12-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.