DPCstruct | MC27021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B4PF83 | 9-133 | KILIVSLGTGFTWLFGAWDTALQVLVGLMILDYTTGVLRAWINKELSSNTGLKGIARKAVIFIVLIVAVMLDRLINTGAWVFRTLVA… |
| A0A4R6BCY0 | 4-123 | TVIITELNVWKELLFSGDMLLLRILFLMTLFDVVSGISKGFAKNELRSRRASEGLARKAHMYFIVIMANVIDQVFNGNGMGVNAVVI… |
| A0A252F2G2 | 39-183 | None |
| A0A1E1VIF7 | 18-145 | None |
| A0A497SBR7 | 27-181 | None |
| A0A3A3GHR8 | 5-143 | None |
| R6ZXC1 | 100-230 | None |
| V9W967 | 3-112 | None |
| A0A2N3JI46 | 9-138 | None |
| A0A1E9IJD8 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.