DPCstruct | MC2702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A076LR89 | 24-124 | DPTFDFCGYLEALPEPDGMYMGNANIIPRQPRLYLYHAYLVYMEAHGYRNALSLTMFGKGLSAMLKEYGLNYDKRRTNQGMQTNLAL… |
| A0A822NJI4 | 1-83 | MLIGNAEIMPFNPRKYLYHSYLAYMKGNNLNKPVSVTRFGMDMPGALAEYGLPYLRKKSKQGIRSNMSLNIETANEWMPKLTR |
| A0A3S4I6M4 | 2-79 | None |
| A0A085G7J7 | 24-106 | None |
| A0A1C0U6E7 | 2-77 | None |
| A0A774DLD3 | 24-101 | None |
| A0A743SNK8 | 167-264 | None |
| A0A2V4DM99 | 176-259 | None |
| A0A2J9E563 | 38-137 | None |
| A0A4V1FG08 | 37-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.