DPCstruct | MC27014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 177 ± 18 aa |
| Standard deviation of domain lengths | 17.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7IP54 | 1-194 | MTSVPHSGAKSVTPGGSVAGGAGWRCFHCDETFTDRRCAAAHFGADEDAAPACQIKGSEVGLVEALRRAEKDAGDAWFAIHNESTEA… |
| T0GJF3 | 171-341 | PAGNGREAVAWRCFHCGETFTDAHLARLHFGRDETSEAACIIKAGAEGSLLKALRDAEEQADDAIQRMHDESTDAAKAFHQQRCRHN… |
| A0A1M5NC57 | 93-283 | None |
| A0A1L3ZSA2 | 23-169 | None |
| A0A7Y9FKP8 | 1-200 | None |
| A0A6I4TSX8 | 145-322 | None |
| F7UAM4 | 64-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.