DPCstruct | MC2701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N6MT64 | 1-51 | MTRDKPPTKISDETLIADVQNYPDDYQWERAKRLGVSQSAIHYALKRLNIT |
| A0A822NDS9 | 1-61 | MTRDKPPTKISDETLIADVKNYPDDYQWERAKRLGVSQSAVHYALKRLKITVKKNAQTPRR |
| A0A090APB5 | 1-63 | None |
| A0A6L2ZQV8 | 89-150 | None |
| A0A6L2ZQS1 | 170-231 | None |
| A0A849NRN9 | 295-354 | None |
| A0A2N9YA51 | 3-57 | None |
| A0A241ZDP6 | 1-74 | None |
| A0A5D3Y7L4 | 2-49 | None |
| A0A6S6RTZ5 | 24-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.