DPCstruct | MC27009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 166 ± 26 aa |
| Standard deviation of domain lengths | 25.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A347TJL4 | 3-130 | KNEKVKLIREIEKPIKIFGKQLKITRVVLILVAFLIYFVSLYYETRSNTPLVLGIIPLVLLSFTLILIKNRILYIGKYNIECSNAGD… |
| A0A5S3V277 | 38-213 | QSQQFHGNNNQGIQIGGDNQGSVVINPVPPEPKKTLIHREKIKPISIANTPVKHWWFTASGALGLVGNLASILGVWLTLGTGEQSPL… |
| A0A2S5V128 | 1-137 | None |
| D4X5P7 | 1-199 | None |
| A0A4R3TGS8 | 3-202 | None |
| A0A0P0RHM0 | 124-277 | None |
| A0A7H8PHJ1 | 1-171 | None |
| A0A2S8VD38 | 5-153 | None |
| A0A6B8HG40 | 72-269 | None |
| A0A0S1XVW0 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.