DPCstruct | MC27007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 60.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453CGR5 | 1-113 | MGCGLSTPDNDGGGGEGARRKQGSVGDVVVFVPGLRAPMGVDLSQALAGRLDKSAVERLSALRARVVDMAMQESAVALKPRRKTAAR… |
| M0WF19 | 1-114 | MGCGASVPNGKGRKRRSVVQEVAVFIPTIRVPVATDVVHPLRGLVSKELVDHLATLRSKVVLLAEDIYHGDMSAVSELQRALEEYLP… |
| A0A6S7LF24 | 76-201 | None |
| W9RQ79 | 1-108 | None |
| A0A7N2KK46 | 1-107 | None |
| A0A5B6WMX4 | 1-121 | None |
| A0A835IJ33 | 1-104 | None |
| A0A426ZCW6 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.