DPCstruct | MC27002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 400 ± 90 aa |
| Standard deviation of domain lengths | 89.76 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.65 |
| Pfam Score | 46.67 |
| Assigned Pfam label(s) | PF09484- PF09709 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4DW57 | 1-203 | PRPLSLFQLAASTVRDARSDLPVTAPRSLFRAALSATPLPLELAFQAVRRCRAEQGVTRPRAALIKLVLLSRETTPPEEEYMVALET… |
| A0A3G6JEG7 | 21-389 | AANAKLISANDTTNFTFKGRFLTADEAVTIGYDSSQKAHAAMKWLLTKQGFKIGDRYYLAWEVNGENTADLSIVSQNPLLALAQKKF… |
| A0A3C0A170 | 111-572 | None |
| A0A221W332 | 2-276 | None |
| A0A369TA45 | 120-654 | None |
| A0A0R1NUD7 | 121-647 | None |
| A0A2R6LKD7 | 4-384 | None |
| A0A7G5MYQ6 | 88-521 | None |
| A0A0D0S9U9 | 2-370 | None |
| S9S0V0 | 326-724 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.