DPCstruct | MC27001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 95 ± 25 aa |
| Standard deviation of domain lengths | 25.07 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 71.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 59.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3QKV7 | 1-69 | MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKSGDARVALIG |
| A0A7R9GDA7 | 1-63 | MSIVEKIAQIEAEMARTQRNKATAGHLGLLKARLAKLRRELITPKGGGGGTGEGFDVAKTGDA |
| A0A5D6XKX2 | 1-121 | None |
| A0A1I7WX43 | 101-171 | None |
| A0A0R3RTD7 | 85-153 | None |
| A0A1I8HCB6 | 2-118 | None |
| A0A7I8VS62 | 1-63 | None |
| A0A3P6CFV6 | 2-136 | None |
| A0A2G3B3P8 | 2-116 | None |
| A0A1Q9C1Q8 | 4-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.