DPCstruct | MC270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 4 aa |
| Standard deviation of domain lengths | 3.74 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5BS12 | 1-100 | MVYIADTGKVYHLKSTCSYLRVSLEAVSAKELPGRRNESGGKYYPCERCIEDGKKTSIVYITGSGDHYHGQITCGGLKRTVRMVPLS… |
| R9JP37 | 218-321 | EDEDGQIVYVTDTGTVYHTNYQCSYLQLSIRFLASSGLSGIRNLGGGRYRSCEKCVQGRAMAGVYVTDSGNRYHNSLNCSGLKRSIR… |
| A0A3A6L642 | 145-249 | None |
| A0A3R6UNE1 | 91-197 | None |
| A0A7J0B7G6 | 49-154 | None |
| A0A1I0RCX9 | 220-315 | None |
| A0A1G9FNX8 | 269-376 | None |
| A0A3R6QDT3 | 146-250 | None |
| A0A3P2AIQ5 | 232-329 | None |
| A0A1I5WKB9 | 130-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.