DPCstruct | MC27
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 411 ± 62 aa |
| Standard deviation of domain lengths | 62.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2TZ89 | 25-445 | AWMAEQNTGMANGHCYGMSVTSLLLAGHELDPAKYGAESTVKLNLADNPALQEMIAQQFVGQWMPDVVAGQVKGTPKQVVDKLVEVL… |
| A0A6J7P5W3 | 2-421 | VAMFGNGAEICTSTSSPCTLTAEAAAWARMVNQARSSGHCEGLAVLSASRFQEKSTPATFSLQNSGDTTHAIIRAFATQFLNETTNA… |
| A0A538Q8W6 | 304-785 | None |
| A0A081BLL4 | 62-524 | None |
| K9Q6N6 | 42-552 | None |
| A0A2N9YAZ1 | 198-637 | None |
| A0A3L7WUU1 | 50-511 | None |
| A0A7C7URH0 | 59-429 | None |
| A0A6J6I027 | 6-418 | None |
| A0A7J2SGT0 | 442-711 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.