DPCstruct | MC26996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13797 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2WPG2 | 14-96 | DENRKLREQLMPALESKCDEFRLLGYTQVTMDGLWECLCSRKWKHRPAEKKLHELVSDIFSLSPSEYMMFLTMRSYKQQAAGD |
| A0A419SIZ9 | 7-80 | SLEELEREMGAICQSKAEEFHLLGYEQVSADEIWECVSTNYAQEVPPLHKVVNDILSLTVTKFMNWMMMKMYRG |
| A0A401HXW4 | 35-127 | None |
| A0A3D9KN08 | 110-204 | None |
| A0A2S5GF28 | 35-139 | None |
| A0A1K1RC06 | 196-293 | None |
| A0A7U3ABA0 | 17-88 | None |
| A0A7W2AQT6 | 5-95 | None |
| A0A264YZR0 | 15-128 | None |
| A0A5R8QCP4 | 4-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.