DPCstruct | MC26995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03611 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A099DBU1 | 1-125 | IMYVPFGIATNYIIEKIPGVSKINLEPETINKKFGVFGEPLTLGFILGLVLALMAGYSISESVALAVTVSAAMLLLPKMIEILVQGL… |
| A0A844UIA5 | 59-164 | VVFFPVGLLVDKIIDHIPGLNRIHIDPETVQKKFGIFGEPMMVGTILGILLGVIAGYDFKKVLLLGISIGGVMFILPRMVRILMEGL… |
| A0A6N8MVD6 | 1-108 | None |
| A0A5S9M930 | 1-117 | None |
| A0A090T9Q9 | 35-153 | None |
| A0A081BHL2 | 119-230 | None |
| A0A5D0EHV6 | 468-568 | None |
| A0A6V8NKC3 | 1-115 | None |
| A0A8A5G2U5 | 11-116 | None |
| A0A1L8SV35 | 177-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.