DPCstruct | MC26994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833SUH5 | 15-81 | FRARWDELKKIGWMSKRPTGLFNLHTYIQSDKTRDGVRDEDYFVGKEKLMRYLDRQEVKILGRVIAL |
| A0A6A3M426 | 6-78 | KSFQQIWRELTKKGWTYKRSTGLSNDQRYLPPGGNVKGKEGVDYFIGEGSLLRYCRRQGWLAFGQPTATAGTA |
| A0A6G0QQC5 | 1-62 | None |
| A0A6A3NDK7 | 1-93 | None |
| A0A6A3MD07 | 41-116 | None |
| D0N207 | 5-74 | None |
| V9EJW3 | 1-61 | None |
| A0A2P4YVQ0 | 18-88 | None |
| W2YVX3 | 7-87 | None |
| A0A2P4YSP8 | 3-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.