DPCstruct | MC26992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D6XN55 | 1-153 | MTALTRTSAGTGARRVRLLLLLALALAVALFVALFRRGGPSAADIFAPRLNDLELVRHPRPRDVWTAADFECLGWRATRACDPLGAR… |
| A0A6A3LZ00 | 1-169 | MKWRSSACTKVSARDASASSPRRSSAGRWLLYLLLLSVASSSSLLLVWSSAPLSPFRSPLNGSELTQTGKLSALPMGDTVERNLRCI… |
| A0A833T4B7 | 1-186 | None |
| W2PDU3 | 1-185 | None |
| A0A6A3TZ36 | 15-202 | None |
| G4ZDV3 | 12-189 | None |
| A0A833TG83 | 47-218 | None |
| A0A1Y2BXP2 | 4-154 | None |
| A0A3R7VZ90 | 619-775 | None |
| A0A6A3FFM1 | 101-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.