DPCstruct | MC26991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 131 ± 28 aa |
| Standard deviation of domain lengths | 27.93 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 98.17 |
| Assigned Pfam label(s) | PF04479- CL0028- PF02586- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0MF04 | 240-367 | TNTDISAFRAKGGKIIMTHGLADEIVSTDSSTDDYNGLVDRFGRGKVDRFVRFYLMPGVRHGTGPFHPAIDSLSALDRWVKSGTAPE… |
| A0A6A3LX03 | 326-448 | HPLLDATNPDLTAFKAAGALEKQMGGAEQVGEFERLYLFPGVQHCGRGEGMAAFDLVTSLLEWVEQGNAPHAVLTSTERDLPPWMPA… |
| A0A0S7DMF2 | 573-720 | None |
| A0A395GY66 | 566-680 | None |
| A0A2S4KXL5 | 52-178 | None |
| A0A4Y8D1S7 | 1-87 | None |
| N4VHF1 | 380-541 | None |
| W2PBM1 | 302-445 | None |
| R1GB13 | 112-254 | None |
| R1GJ11 | 871-1024 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.