DPCstruct | MC2699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 132 ± 21 aa |
| Standard deviation of domain lengths | 21.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0RHG5 | 7-117 | LAIVERALGSCAYADLSLAANASILVADASCTTVPVCGVRPNCKVYDSFSSDWSSYVRFDAIGDLSGYTQPNLTVANWSTLTLVKMK… |
| T0R7M4 | 4-109 | TPCPYAEAGAKVLVADDTCAGGVCVVNSKCKVVDRFNDTFDTFSNLSAIGRFDKYTRTALTVEDSASVDLRLMELPPSVTSLTFSDI… |
| A0A485KVY6 | 8-100 | None |
| A0A485KGU8 | 1-148 | None |
| A0A485KCV5 | 1-153 | None |
| A0A0A7CNZ4 | 1-126 | None |
| A0A0A7CNJ8 | 3-106 | None |
| A0A067C3R1 | 1-136 | None |
| A0A067C3L5 | 4-137 | None |
| A0A067BM56 | 11-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.