DPCstruct | MC26988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3EH85 | 110-220 | DQHVHSLPQMLEVNRNVEYLDVVVADLQEYAEDFKKHNHQPTNRSIKLAMESKTAFLSVLAFGNSQSSKWHKPSQSQSTLPQLDQLI… |
| G5A8D4 | 96-201 | LAKLLLVLEANQSLEHLDVIAPTQYHHEFFEKFRAHHLTPIRKTMPLSLKSKIAFLSIISCSRAQTGDERALEPEISCFALDQHFVR… |
| W2PKH6 | 50-190 | None |
| D0NKS5 | 113-225 | None |
| W2MX82 | 1-104 | None |
| A0A6A3HYZ8 | 99-211 | None |
| A0A0W8D904 | 306-416 | None |
| A0A329SNH9 | 2-102 | None |
| A0A0W8CZ71 | 399-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.