DPCstruct | MC26983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 183 ± 24 aa |
| Standard deviation of domain lengths | 24.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2K164 | 1-159 | NNIKTEKVVTRTKATVEPDKTHINEKMARTLHDLVDEIVKLEKAVKQKPKSFQAVWSSLNRHCGVTAYRLIALQDYEKAELYLRKWV… |
| A0A828RQR6 | 35-231 | SANLNAVSDDLNKKLDDAIGKSNVENQINGNVSNAVIASSGSVVHQINTQNHVIRTRVDSKPGKEHITLEQASKLQQLVKQVAAAEE… |
| A0A1E2VLR4 | 1-177 | None |
| A0A2T5REA1 | 87-283 | None |
| C5BGX9 | 1-161 | None |
| A0A354T954 | 56-299 | None |
| A0A7U4P2S8 | 1-208 | None |
| A0A6C2DM45 | 1-168 | None |
| A0A6P2NAL4 | 1-170 | None |
| A0A2X4TQW1 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.