DPCstruct | MC26980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1214 |
|---|---|
| Mean domain length (aa) | 105 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 99.80 |
| Assigned Pfam label(s) | CL0318- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P83391 | 2-88 | DAELLADGKKVFAGNCAACHLGGNNSVLADKTLKKDAIEKYLEGGLTLEAIKYQVNNGKGAMPAWADRLDEDDIEAVSNYVYDQAVN |
| A0A1U7GS10 | 5-97 | EVPGDPREGTADADVAKGGQLYLIVCASCHGPTAVGTELGPALANRAVLTHAEDYHKQVRDGLRKMPAMNTVLNAEQQRDILGWLRA… |
| A0A6N0E1E5 | 6-133 | None |
| A0A3D4HCY3 | 213-347 | None |
| A0A7W5IKN4 | 19-110 | None |
| A0A354VHK3 | 30-140 | None |
| A0A2A2Y8H5 | 106-209 | None |
| A0A1W9W5F1 | 247-373 | None |
| A0A354TAA0 | 718-838 | None |
| A0A7J9Z080 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.