DPCstruct | MC2698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 226 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.83 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0247- PF04457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8WGV6 | 1-238 | MALKLVRSLLSNSRLHKDRFIVVYRDNFAGLLEEPLNAFSWNFDGDFGWCPIVVPGWQIEKLKYNSRVVWSKTLERQFDEVYRLCLE… |
| A0A2R5GI69 | 1-230 | MRPAMDVVNRILWDEGLPNHAFVVGYLDRFVGVKEKAISAFNFHDDFGSISHTETAIPQTRIQYLKYVHQDGSRLVWDRRPESRADD… |
| U9SIQ6 | 6-195 | None |
| A0A654H4G8 | 4-236 | None |
| A0A074ZFU0 | 162-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.