DPCstruct | MC26973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3R1K3 | 10-144 | EFTKEEMKQRAIKRVAQVIYGQWEEGRGVHSRIFEVLVPDDFVLDGVSKKGNDYREHIVPCVLIRNHANKMFDQGFTIEDVESMIND… |
| A0A6S6UIP9 | 2-133 | ILDMDLSYGTRFCVASEILWVWSEFYGKHKGCKYWSEEALRIWPTQEPSVKGLVHEHLIPRKVLIHKLFNEVERDQHKIYEFLEKFC… |
| A0A4Q3XUX1 | 1-152 | None |
| A0A382YUY7 | 22-176 | None |
| A0A179BLS8 | 1-119 | None |
| A0A5C7L4I1 | 24-172 | None |
| A0A5B9YXS1 | 91-228 | None |
| A0A6L4Z1G1 | 2-174 | None |
| A2C957 | 153-297 | None |
| A0A4U1IVW8 | 117-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.