DPCstruct | MC2697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 682 |
|---|---|
| Mean domain length (aa) | 146 ± 24 aa |
| Standard deviation of domain lengths | 23.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 10.42 |
| Pfam Score | 22.27 |
| Assigned Pfam label(s) | PF20458- PF18906- CL0187- PF06995- PF05638 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D3FRA8 | 9-146 | AAAHNFGLQIDGTTVEYLQRVSGLGQEQDVIEFKQNSAKGQPATAKMPGVAKAGEIQVVRATTQSQAFSDWIKKSFEGDMSAARKNA… |
| A0A285QMK2 | 12-150 | HIQFGEQLLLGPGTAYRWRSLTGWEDSPPLDSGTVNRPAGHGAYPGELWAQPRTITVEGITIRAPVSQLGETVRRFGAGTSSMDAEQ… |
| A0A2D6E6J6 | 20-217 | None |
| A0A0M9ZZF0 | 4-167 | None |
| A0A2T2RS55 | 128-239 | None |
| A0A377ZDF1 | 10-151 | None |
| A0A7X7VGY4 | 2-147 | None |
| A0A2D6E271 | 52-178 | None |
| A0A2D6E635 | 19-200 | None |
| A0A243RVS7 | 122-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.